swanticker 100 Pieces of Cute Animal Stickers for Kids. Waterproof Vinyl Sticker - Aesthetic Sticker Bag for laptops, Water Bottles, Skateboards, Mobile Phones, Guitars, Teenagers, Boys and Girls
$7.99
Features
🦒 Cute water bottle stickers: Each package contains 100 animal stickers, including all major patterns, not random or repeated. Different combinations will give you different visual effects. This is an interesting experience. Cute stickers are the best gifts for kids.
🦒 High Quality Waterproof Sticker: The water bottle sticker is made of vinyl material. To ensure bright colors, the surface of the sticker is waterproof and sunscreen, safe and non-toxic, and the middle is high-definition printing technology, which can be torn off without residue.
🦒 Fashion decoration suitable for various styles: Animal stickers are unique and cute. Every child has his own imagination, so we designed a unique colorful cute animal sticker. Our beautiful and lovely stickers can be used to decorate water bottles, stationery boxes, skateboards, laptops, scrapbooks, parties, room decorations, etc.
🦒 Best DIY Kids Sticker Gifts: Our sea animal stickers are designed for all the kids who love stickers. The stickers are cute, vsco. You can give this scrapbook sticker to your child as a gift bag filler. Teachers and parents can reward students and children with super cute water bottle stickers to remind students and children to keep going to school. You can even share with everyone.
🦒 High quality after-sales service: customer satisfaction is our biggest driving force. We cooperate with Amazon FBA to provide you with the highest quality Amazon Prime transportation. If you have any questions about animal stickers, please feel free to contact us, and we will provide you with quality after-sales service.
Details
kgfrfudrevewybrgheupyurbeggs?kfurherhurSwker100PeesfuemSkersfrKds!Ehpkges100drbemskers,esurgyugevreyfdfferepersfredessusmzpssbes.hesewerprfvyskersreperfefrdergpps,werbes,skebrds,mbephes,gurs,dmre.eyurmgruwdwhheseuedvbrskershresurebrgsmeyhd'sfe.
skersrereedequ,whhswhyurhgh-quywerprfskersremdefrmdurbevymer.Whbrghrsdwerprf,susreesurfe,heseskersreysfed-xbusesyremvewhuevgyresdue.hehgh-defprgehgyesureshhedesgsrerspder,ddguhfhrmyurbeggshwsfrgme.
dduhffshdwhmsyyursyewhuruqueddrbemskers.heserfuskersreperfefrperszgwerbes,serybxes,pps,skebrds,srpbks,dmre.eyurrevyshewhhesefudverseskershresuremkesemewhereveryug.Wheheryu'reeeger,by,rgr,heseskersremus-hveessryexpressyurdvduy.
kgfrheperfegffrsker-vghd?urSwker100PeesfuemSkersfrKdsrehedehe!heseuedVs-spredskersmkegregfsfrbrhdys,hdys,rsmpyshwyurppre.ehersdpreseveusehemsrewrdsfrsudes,eurgghemexesh.Shrehejyfhesesuperueskerswheveryeyukwdspredhevefrevydfu.
usmerssfsurpprry,whhswhywefferhgh-quyfer-sesserveesureyuhvepesshppgexperee.PreredwhmzFB,weprvdefsdrebemzPrmeshppgdeveryurskersprmpy.fyuhveyquessrersbuurdrbemskers,d'heserehuus.Werehereprvdeyuwhexepfer-sessuppresureyurmpeessf.
Discover More Best Sellers in Stickers
Shop Stickers
$9.99
Stickers - Fashion Angels Squishmallows Vinyl Sticker Pack - Includes 100 Large Squishmallows Stickers - Water Resistant Stickers - Join The Squish Squad - Accessorize Notebooks, Journals & More - Multi (50433)
$4.99
Stickers - 72 Pack Halloween Pumpkin Decorating Stickers, Pumpkin Face Stickers in 36 Different Designs for Halloween Kids, Pumpkin Decorating Craft Kit for Kids Halloween Party Favors Supplies 36 Sheets (4”x6”)
$5.97
Stickers - ArtCreativity Halloween Pumpkin Stickers for Decorating - 12 Sheets - Jack-o-Lantern - 26 Pumpkin Decorating Stickers - Cute Halloween Toddler Decor Idea - Pumpkin Party Favors - Halloween Favors
$13.99
Stickers - 20 Sheets (650Pcs) Blue Dog Temporary Tattoos Stickers for Kids, Blue Dog Birthday Party Supplies Decorations Party Favors, Gifts for Boys Girls School Classroom Rewards
$5.86
Stickers - 48 Pack Halloween Pumpkin Decorating Craft Stickers Mini Make 48 Small Pumpkin Face Stickers Monster Stickers for Halloween Kids Toddlers Treats Party Favors Supplies 24 Sheets
$8.95
Stickers - Spidey and His Amazing Friends Activity Set Bundle - Spiderman Coloring Book, Spiderman Stickers, 2-Sided Superhero Door Hanger and More, Red
$7.99
Stickers - 50 Pieces Christmas Scratch Off Cards Stickers Christmas Party Games Vouchers Festive Raffle Tickets Holiday Business Prize Drawings for Kids Adults Families Events Groups (Snowman)
$14.99
Stickers - 300 PCS Halloween Stickers for Kids, Halloween Pumpkin Stickers Bulk for Water Bottles, Vinyl Waterproof Stickers for Halloween Party Favors Crafts Games Halloween Gifts for Kids Teens Adults
Stickers - Jelly Stickers Book for Kids 2-4, Reusable Stickers,4 Scenes| Animals, Dinosaurs, Letters, Vegetables and Fruits,Restickable Sticker Book for Kids, Perfect for Travel Activities, Screen-Free Fun Toys

